DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and gammaTry

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:259 Identity:93/259 - (35%)
Similarity:133/259 - (51%) Gaps:18/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLLAVCVSQG----SGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTA 70
            |||.||..:.|    .|| |.|.:||:|||.|...:|.|:.:|:|..|:|.|..:|.:||.:|||
  Fly     6 ILLSAVACALGGTVPEGL-LPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69

  Fly    71 AHCLANRNQVLGSTLV--AGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTW 133
            ||||   ..|..|.|.  |||...:....|.   .::.:..::.|...|:..||.:|....|.|:
  Fly    70 AHCL---QSVSASVLQIRAGSSYWSSGGVTF---SVSSFKNHEGYNANTMVNDIAIIKINGALTF 128

  Fly   134 TAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDV 198
            ::.:..:.|.||.......|.:.|||:.| ..|.|.|..||.. |:.|:|...||::....|..:
  Fly   129 SSTIKAIGLASSNPANGAAASVSGWGTLS-YGSSSIPSQLQYV-NVNIVSQSQCASSTYGYGSQI 191

  Fly   199 HTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAAN 262
            .:|.:|..  ..|...|..|||||||.|.||:|:|||| ..|...|.|.||..|::..:|:.:|
  Fly   192 RSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWVISN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 80/229 (35%)
Tryp_SPc 32..262 CDD:238113 80/231 (35%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 80/229 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.