DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:264 Identity:83/264 - (31%)
Similarity:133/264 - (50%) Gaps:19/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LATILLLAVCVSQ----GSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWL 67
            |:|:.|..|.|.:    |:..|:::|. |||||..||:...|:.||::.|..|:|.|.::...||
Human   510 LSTVPLDWVTVPKLQECGARPAMEKPT-RVVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWL 573

  Fly    68 VTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFT 132
            ::||||. |..:|.......|:.::.|...:..|..:...|::.||..|.:.:|:.::...:...
Human   574 LSAAHCF-NHTKVEQVRAHLGTASLLGLGGSPVKIGLRRVVLHPLYNPGILDFDLAVLELASPLA 637

  Fly   133 WTAAVAPVKLPSSGVR-PTG-KADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKG 195
            :...:.||.||.:..: |.| |..:.|||:|.:.|: :.|:.||:| ::.||...:|:.......
Human   638 FNKYIQPVCLPLAIQKFPVGRKCMISGWGNTQEGNA-TKPELLQKA-SVGIIDQKTCSVLYNFSL 700

  Fly   196 QDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNV-----LIGIVSWGKLPCGQPNSPSVYVQVSSF 255
            .|   ..:|.|.|.|....|..||||||.....     |.|||||| :.|.|...|.||.:::..
Human   701 TD---RMICAGFLEGKVDSCQGDSGGPLACEEAPGVFYLAGIVSWG-IGCAQVKKPGVYTRITRL 761

  Fly   256 ITWI 259
            ..||
Human   762 KGWI 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 73/234 (31%)
Tryp_SPc 32..262 CDD:238113 74/235 (31%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.