DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and KLK3

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:240 Identity:78/240 - (32%)
Similarity:109/240 - (45%) Gaps:21/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGT 95
            |:|||.....:|.|:.|.:...|...|...:::..|::|||||:.|:     |.::.|..::...
Human    24 RIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNK-----SVILLGRHSLFHP 83

  Fly    96 ASTTQKRQITHYVINDLY-----------TGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRP 149
            ..|.|..|::|...:.||           .|....:|:.|:........|.||..:.||:.....
Human    84 EDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPAL 148

  Fly   150 TGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSF 214
            .......||||.......: ||.|| ..::.:||.|.||..   ..|.|....||.|..|||.|.
Human   149 GTTCYASGWGSIEPEEFLT-PKKLQ-CVDLHVISNDVCAQV---HPQKVTKFMLCAGRWTGGKST 208

  Fly   215 CTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            |:.|||||||...||.||.|||..||..|..||:|.:|..:..||
Human   209 CSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 76/238 (32%)
Tryp_SPc 32..262 CDD:238113 77/239 (32%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 77/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.