DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Try29F

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:266 Identity:84/266 - (31%)
Similarity:117/266 - (43%) Gaps:26/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HRHLATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLV 68
            |..:..|||  |.:|.|:.:...:.:||:|||:.|.....||.||:| ...|:|..::|...|::
  Fly    16 HLFIGGILL--VNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVL 77

  Fly    69 TAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTW 133
            |||||......:|....:..|....|......||...|... |.|   |:.:|..|:........
  Fly    78 TAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKF-DAY---TIDFDFSLLELEEYSAK 138

  Fly   134 TAAVAPVKLPSSGVRPTGKADL--------FGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAA 190
            ....|.|.||..      .||:        .|||:|......|   .:..:..:|.:|...|..|
  Fly   139 NVTQAFVGLPEQ------DADIADGTPVLVSGWGNTQSAQETS---AVLRSVTVPKVSQTQCTEA 194

  Fly   191 LGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSF 255
            .|:.| .:....||.|...||...|..||||||....||.|:|||| ..|.:||.|.||.:||:.
  Fly   195 YGNFG-SITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAV 257

  Fly   256 ITWIAA 261
            ..||::
  Fly   258 RDWISS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 74/235 (31%)
Tryp_SPc 32..262 CDD:238113 75/238 (32%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 74/235 (31%)
Tryp_SPc 42..264 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.