DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and PRSS53

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:330 Identity:82/330 - (24%)
Similarity:126/330 - (38%) Gaps:102/330 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ATILLLAV------CVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNW 66
            ||:|:..:      |..:|.|....| ||..|.|:      .|:..|::..|.|.|:.:::...|
Human    14 ATVLMEGLQAAQRACGQRGPGPPKPQ-EGNTVPGE------WPWQASVRRQGAHICSGSLVADTW 71

  Fly    67 LVTAAHC--------LANRNQVLGST----LVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVP 119
            ::|||||        |.:.:.||||.    |..|:..| |.|:....|...|      |:.|:  
Human    72 VLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEV-GVAALQLPRAYNH------YSQGS-- 127

  Fly   120 YDIGLIYT--PTAFTWTAAVAPVKLPSSGVR-PTGKAD-LFGWG--------------------- 159
             |:.|:..  ||..|      |:.||....| |.|.:. ..||.                     
Human   128 -DLALLQLAHPTTHT------PLCLPQPAHRFPFGASCWATGWDQDTSDGKCWPRLKLGEALCLP 185

  Fly   160 --STSKTNSPSY--------------------PKTLQEAKNIPIISLDSCAAALGSKGQDVHTTN 202
              :.|..|.|.:                    |.||:..: :.:||..:|........|. |.:|
Human   186 SVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLR-LRLISRPTCNCIYNQLHQR-HLSN 248

  Fly   203 ------LCTGPLTGGTSFCTSDSGGPLV----QGN-VLIGIVSWGKLPCGQPNSPSVYVQVSSFI 256
                  ||.||..|....|..|||||::    .|: |..||:|:.. .|.|.::|.:....::..
Human   249 PARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFAS-SCAQEDAPVLLTNTAAHS 312

  Fly   257 TWIAA 261
            :|:.|
Human   313 SWLQA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 71/297 (24%)
Tryp_SPc 32..262 CDD:238113 73/300 (24%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 72/298 (24%)
Tryp_SPc 43..314 CDD:214473 71/295 (24%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.