DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG1304

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:272 Identity:72/272 - (26%)
Similarity:117/272 - (43%) Gaps:48/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCL 74
            :|||||.|....|    ...||||||:.|..|..|:.||::..|:|.|..:|::.|:::|||||:
  Fly    14 LLLLAVPVHSAPG----SLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCV 74

  Fly    75 ANRNQVLGSTLVA---------------GSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGL 124
            .|::....|..:|               |.:.|          |:...::::.|  |....|:.|
  Fly    75 TNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLV----------QVAEVIVHEEY--GNFLNDVAL 127

  Fly   125 IYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAA 189
            :...:....:|::.|:.||::.........:.|||...  :....|:.|| ...:..|||:.|..
  Fly   128 LRLESPLILSASIQPIDLPTADTPADVDVIISGWGRIK--HQGDLPRYLQ-YNTLKSISLERCDE 189

  Fly   190 ALGSKGQD----VHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYV 250
            .:|...|.    :|..:         ...|..|||||.|..|.::|:..:....|| .:.|..|.
  Fly   190 LIGWGVQSELCLIHEAD---------NGACNGDSGGPAVYNNQVVGVAGFVWSACG-TSYPDGYA 244

  Fly   251 QVSSFITWIAAN 262
            :|.....||..|
  Fly   245 RVYYHNEWIKNN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 61/246 (25%)
Tryp_SPc 32..262 CDD:238113 62/248 (25%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 61/246 (25%)
Tryp_SPc 32..256 CDD:238113 62/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.