DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG9673

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:266 Identity:74/266 - (27%)
Similarity:116/266 - (43%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLALD---QPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGS 83
            ||.|.   .|:||::||:..|....|:..|::|...|.|:..||::|.::|||||:::    :|.
  Fly    16 GLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSS----VGI 76

  Fly    84 TLV-AGSIAV--------AGTASTTQKRQITH--YVINDLYTGGTVPYDIGLIYTPTAFTWTAAV 137
            |.| |.::||        ||.:....|..|.|  |        |...:||.::.......::..:
  Fly    77 TPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSY--------GNFLHDIAILELDETLVFSDRI 133

  Fly   138 APVKLPSSGVRPTGKAD----------LFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALG 192
            ..:.||.:....|...|          :.|||..| ..:.||.   |:..|...:|...|....|
  Fly   134 QDIALPPTTDEETEDVDAELPNGTPVYVAGWGELS-DGTASYK---QQKANYNTLSRSLCEWEAG 194

  Fly   193 SKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGN-VLIGIVSWGKLPCGQPNSPSVYVQVSSFI 256
            ...:.|    :|.. ...|...|..|:|..::..: ||.|:.|:...|||. ..|.|..:||.::
  Fly   195 YGYESV----VCLS-RAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDVATRVSYYL 253

  Fly   257 TWIAAN 262
            |||.||
  Fly   254 TWIEAN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 65/249 (26%)
Tryp_SPc 32..262 CDD:238113 66/251 (26%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 65/249 (26%)
Tryp_SPc 29..259 CDD:238113 66/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.