DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG9676

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:260 Identity:69/260 - (26%)
Similarity:117/260 - (45%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLAVC----VSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAH 72
            ||.:|    ::|...:.    |.|:|||..|.....|:.:|::..|:|.|..:||:.:::|||||
  Fly     8 LLVLCAAGVLAQNDSVV----EPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAH 68

  Fly    73 CLANRNQVLGST---LVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWT 134
            |:...|.|..:.   :.|||:.::..........:|   ::..|...  .:|:.::....:.|:.
  Fly    69 CVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVT---VHPNYNSN--GHDVAVLRLRNSLTFN 128

  Fly   135 AAVAPVKLPSSGVRPTGKADLFGWGSTSK----TNSPSYPKTLQEAKNIPIISLDSCAAALGSKG 195
            :.:|.:||.:.........|:.|||:.|:    :||..|.:       :..:|.:||....  ..
  Fly   129 SNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQ-------VKALSRESCQKTY--LR 184

  Fly   196 QDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWIA 260
            |...||.....|...|.  |..|||||......|:|:.|:....||:. :|..|.:||....|||
  Fly   185 QLPETTMCLLHPKDKGA--CYGDSGGPATYQGKLVGLASFVIGGCGRA-APDGYERVSKLRNWIA 246

  Fly   261  260
              Fly   247  246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 61/234 (26%)
Tryp_SPc 32..262 CDD:238113 63/236 (27%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 61/234 (26%)
Tryp_SPc 28..248 CDD:238113 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.