DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG32808

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:277 Identity:84/277 - (30%)
Similarity:128/277 - (46%) Gaps:46/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WRHR----HLATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQ--YGGTHYCAAN 60
            |..|    :.||.||     :..||     .:|::|.|..|.....|::||::  ..|.|.|.|.
  Fly     6 WLARLALFYTATFLL-----AGASG-----EDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGAT 60

  Fly    61 IINSNWLVTAAHCL--ANRNQV---LGSTLVA-GSIAVAGTASTTQKRQITH--YVINDLYTGGT 117
            ::|..|::|||||:  ::..|:   .||.::| .|..||..|:.     ..|  |...|.|..  
  Fly    61 LLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAI-----FVHPGYEPEDKYVN-- 118

  Fly   118 VPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKAD--LFGWGSTSKTNSPSYPKTLQEAKNIP 180
               ||.|:....:...:..|.||:||.......|.|.  |.|||..:  ......:.||:.| :.
  Fly   119 ---DIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNA--TGGVVQQHLQKVK-LQ 177

  Fly   181 IISLDSCAAALGSKGQD-VHTTNLCTGPLTGGTSFCTSDSGGP--LVQGNVLIGIVSWGKLPCGQ 242
            :.|...|:    .:.|. :|.:.:|.|...||...|:.|||||  |:..:..:|||||...||.:
  Fly   178 VFSDTECS----ERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCAR 238

  Fly   243 PNSPSVYVQVSSFITWI 259
            |..|.|:.:||:::.||
  Fly   239 PPFPGVFTEVSAYVDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 73/242 (30%)
Tryp_SPc 32..262 CDD:238113 75/243 (31%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 73/242 (30%)
Tryp_SPc 30..258 CDD:238113 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.