DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG32523

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:280 Identity:74/280 - (26%)
Similarity:130/280 - (46%) Gaps:43/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVC---VSQGSGLALDQPEG----RVVGGKAAAANSAPYIVSMQYGGTHYCA 58
            ||  ..|.|:|||.:|   |..|..:|.:|.|.    |:|||..|.....|:.:|::..|.|||.
  Fly     1 MW--TTLWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCG 63

  Fly    59 ANIINSNWLVTAAHCLANRNQVLGS---TLVAGSIAVAGTASTTQKRQITHYVINDLY-TGGTVP 119
            ..||::..::||.||:.:.|.|:.:   ::.|||:.:   :|...:..:...:::..| |||  .
  Fly    64 GVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL---SSDGVRIPVAEVIMHPNYATGG--H 123

  Fly   120 YDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISL 184
            .|:.::...:..|:.|.:|.::|.:.........|:.|||:.::....|......:   :..||.
  Fly   124 NDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQ---VTSISR 185

  Fly   185 DSCAAALGSKGQD-----VHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVS----WGKLPC 240
            .:|.....|:..:     :|:.|         :..|..|||||...|..::|:.|    .|   |
  Fly   186 GACRWMFYSRLPETMICLLHSKN---------SGACYGDSGGPATYGGKVVGLASLLLGGG---C 238

  Fly   241 GQPNSPSVYVQVSSFITWIA 260
            |:. :|..|:::|....|||
  Fly   239 GRA-APDGYLRISKVRAWIA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 58/240 (24%)
Tryp_SPc 32..262 CDD:238113 60/242 (25%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 58/240 (24%)
Tryp_SPc 37..219 CDD:238113 46/198 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.