DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Tmprss6

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:251 Identity:80/251 - (31%)
Similarity:109/251 - (43%) Gaps:30/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGS----TL 85
            |..|..|:|||..::....|:..|:|..|.|.|...:|...|::|||||.  :...:.|    |:
  Rat   570 LQGPSSRIVGGAMSSEGEWPWQASLQIRGRHICGGALIADRWVITAAHCF--QEDSMASPRLWTV 632

  Fly    86 VAGSIAV----AGTASTTQKRQITH-YVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLP-- 143
            ..|.:..    .|..|....|...| |...|.:     .||:.|:.......::|.|.||.||  
  Rat   633 FLGKMRQNSRWPGEVSFKVSRLFLHPYHEEDSH-----DYDVALLQLDHPVVYSATVRPVCLPAR 692

  Fly   144 SSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPL 208
            |....|.....:.|||:..:....|  .|||:. ::.:|..|.|..|.   ...|....||.|..
  Rat   693 SHFFEPGQHCWITGWGAQREGGPGS--STLQKV-DVQLIPQDLCNEAY---RYQVTPRMLCAGYR 751

  Fly   209 TGGTSFCTSDSGGPLV----QGN-VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            .|....|..|||||||    .|. .|.|:|||| |.||:||...||.:|:..:.||
  Rat   752 KGKKDACQGDSGGPLVCKEPSGRWFLAGLVSWG-LGCGRPNFFGVYTRVTRVVNWI 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 76/243 (31%)
Tryp_SPc 32..262 CDD:238113 77/244 (32%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 76/243 (31%)
Tryp_SPc 577..809 CDD:238113 77/244 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.