DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG6041

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:270 Identity:79/270 - (29%)
Similarity:116/270 - (42%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LATILLLAVCVSQGSGLALD---QPEGRVVGGKAAAANSAPYIVSMQ--------YGGTHYCAAN 60
            ||..|.|....| |..|:.:   :.|.::|||..|:.....|.||::        ||..|.|...
  Fly     8 LAIALFLGALAS-GESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGV 71

  Fly    61 IINSNWLVTAAHCL----ANRNQVLGS-TLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPY 120
            :|:...:.|||||.    ..:.:..|. .||.||..:..:...|....:...:.::.|....:..
  Fly    72 VISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTN 136

  Fly   121 DIGLIYTPTAFTWT-AAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISL 184
            ||.|::......|. ..|..:.|.|..|.......:.|||...: |......||| |..:||:|.
  Fly   137 DIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQ-NGTFSSNTLQ-AATVPIVSY 199

  Fly   185 DSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVY 249
            .:|..:..|    :..:.:|.|.|:||...|..|||||:....:|.||||:| ..|..|..|.||
  Fly   200 TTCRISYNS----IPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYG-AGCAAPGYPGVY 259

  Fly   250 VQVSSFITWI 259
            ..||.:..||
  Fly   260 TNVSYYYDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 69/241 (29%)
Tryp_SPc 32..262 CDD:238113 71/242 (29%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 69/241 (29%)
Tryp_SPc 35..272 CDD:238113 71/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.