DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Tmprss9

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:247 Identity:75/247 - (30%)
Similarity:119/247 - (48%) Gaps:15/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGST 84
            |:..|:|:|. |:|||.:|.:...|:..|::.|..|:|.|.::...||::||||. |..::....
  Rat   529 GARPAMDKPT-RIVGGISAVSGEVPWQASLKEGSRHFCGATVVGDRWLLSAAHCF-NHTKLEQVQ 591

  Fly    85 LVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVR- 148
            ...|::::.|...:..|..:....::..|..|.:.:|:.|:.......:...:.||.||.:..: 
  Rat   592 AHLGTVSLLGVGGSPVKLGLRSVALHPRYNPGILDFDVALLELAQPLVFNKYIQPVCLPLAIHKF 656

  Fly   149 PTG-KADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGT 212
            |.| |..:.|||:..:.|: :.|..||:| ::.||....|.|.......|   ..||.|.|.|..
  Rat   657 PVGRKCMISGWGNMQEGNA-TKPDILQKA-SVGIIEQKMCGALYNFSLTD---RMLCAGFLEGRV 716

  Fly   213 SFCTSDSGGPLVQGNV-----LIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            ..|..||||||.....     |.|||||| :.|.|...|.||.:::....||
  Rat   717 DSCQGDSGGPLACEETPGVFYLAGIVSWG-IGCAQAKKPGVYARITRLKDWI 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 69/234 (29%)
Tryp_SPc 32..262 CDD:238113 70/235 (30%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.