DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk12

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:255 Identity:87/255 - (34%)
Similarity:125/255 - (49%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLAVCVSQGSGLALDQPE-GRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCL 74
            :||.:||     :.|.|.: .::..|.....||.|:.|.:.:|....|...:::..|::||||| 
  Rat     5 ILLLLCV-----VGLSQADREKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTAAHC- 63

  Fly    75 ANRNQVLGSTLV-AGSIAVAGTASTTQKRQITHYVINDLYTGG--TVPYDIGLIYTPTAFTWTAA 136
                  .|..:| .|..:::....|.|.|..|..:.:..|.|.  ...:|:.|:......:.|.|
  Rat    64 ------SGKYMVRLGEHSLSKLDLTEQLRLTTFSITHPSYHGAYQNHEHDLRLLRLNRPISLTYA 122

  Fly   137 VAPVKLPSSGVRPTG-KADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHT 200
            |.||.|||| ..||| |..:.|||:|:|...| :|..|| ..::.|:|.::|.|....:   |..
  Rat   123 VRPVALPSS-CAPTGAKCHISGWGTTNKPWDP-FPDRLQ-CLDLSIVSNETCRAVFPGR---VTE 181

  Fly   201 TNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKL-PCGQPNSPSVYVQVSSFITWI 259
            ..||.|. ..|...|..|||||||.|.||.|:||||.: ||||...|.||.:|..:..||
  Rat   182 NMLCAGG-EAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 79/232 (34%)
Tryp_SPc 32..262 CDD:238113 81/233 (35%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 79/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.