DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk1c3

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:271 Identity:84/271 - (30%)
Similarity:130/271 - (47%) Gaps:24/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSN 65
            ||       .|:|.:.:|.|...|....:.|||||.....||.|:.|::.  ....|...:|:.:
  Rat     1 MW-------FLILFLALSLGQIDAAPPGQSRVVGGFKCEKNSQPWQVAVI--NEDLCGGVLIDPS 56

  Fly    66 WLVTAAHCLA-NRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPY--DIGLIYT 127
            |::|||||.: |.:.:||...::..:.....:.:.:......:::.: :|.....|  |:.|::.
  Rat    57 WVITAAHCYSDNYHVLLGQNNLSEDVQHRLVSQSFRHPDYKPFLMRN-HTRKPKDYSNDLMLLHL 120

  Fly   128 PTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPS---YPKTLQEAKNIPIISLDSCAA 189
            ......|..|..:.||:...:......:.|||||    :||   :|..|| ..||.::|.:.|..
  Rat   121 SEPADITDGVKVIDLPTKEPKVGSTCLVSGWGST----NPSEWEFPDDLQ-CVNIHLLSNEKCIK 180

  Fly   190 ALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSS 254
            |...|..|:   .||.|.|.||...|..||||||:...||.||.|||.:|||:||.|.:|.::..
  Rat   181 AYKEKVTDL---MLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIK 242

  Fly   255 FITWIAANQKK 265
            |.:||....||
  Rat   243 FTSWIKEVMKK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 73/233 (31%)
Tryp_SPc 32..262 CDD:238113 74/235 (31%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 73/233 (31%)
Tryp_SPc 25..250 CDD:238113 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.