DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk7

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:265 Identity:84/265 - (31%)
Similarity:115/265 - (43%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAA 71
            |.|:||.....:.|.|       .|::.|......|.|:.|::..|...:|...::..:|::|||
  Rat     8 LLTVLLSLALETAGQG-------ERIIDGYKCKEGSHPWQVALLKGDQLHCGGVLVGESWVLTAA 65

  Fly    72 HCLANRNQV-LGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTA 135
            ||...:..| |||..:....|....||    |...|    ..|:..|...||.|:........:.
  Rat    66 HCKMGQYTVHLGSDKIEDQSAQRIKAS----RSFRH----PGYSTRTHVNDIMLVKMDKPVKMSD 122

  Fly   136 AVAPVKLPSSGVRPTGKADLFGWGSTSKTNSP--SYPKTLQEAKNIPIISLDSCAAA----LGSK 194
            .|..||||.....|.....:.|||:|:   ||  ::|..|. ..::.:||...|...    ||. 
  Rat   123 KVQKVKLPDHCEPPGTLCTVSGWGTTT---SPDVTFPSDLM-CSDVKLISSQECKKVYKDLLGK- 182

  Fly   195 GQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
                  |.||.|.....|:.|..|||||||..:.|.|:||||..||||||.|.||.||..:..|:
  Rat   183 ------TMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYQRWL 241

  Fly   260 AANQK 264
            ....|
  Rat   242 EDTMK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 76/234 (32%)
Tryp_SPc 32..262 CDD:238113 76/236 (32%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 76/233 (33%)
Tryp_SPc 26..244 CDD:238113 76/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.