DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk13

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:275 Identity:87/275 - (31%)
Similarity:130/275 - (47%) Gaps:32/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALDQPE---------GRVVGGKAAAANSAPYIVSMQYGGTHY 56
            ||  ..:|||..|.:.:|  .|::.|.|:         |.:.||.....:|.|:..::...|...
  Rat     1 MW--PLVATIACLTLALS--GGISRDYPKILNGTNGTSGFLPGGYTCLPHSQPWQAALLVRGRLL 61

  Fly    57 CAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLY----TGGT 117
            |...:::..|::|||||..:     |.|:..|..|:....:..|..::...:.:..|    |...
  Rat    62 CGGVLVHPKWVLTAAHCRKD-----GYTVHLGKHALGRVENGEQAMEVVRSIPHPEYQVSPTHLN 121

  Fly   118 VPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGK-ADLFGWGSTSKTNSP--SYPKTLQEAKNI 179
            ..:||.|:...:....:..|..::|.:....|||. ..:.|||:|:   ||  :||||||.| ||
  Rat   122 HDHDIMLLELKSPVQLSNHVRTLQLSADDCLPTGTCCRVSGWGTTT---SPQVNYPKTLQCA-NI 182

  Fly   180 PIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPN 244
            .:.|.:.|......|   :....||.|...||...|..||||||:....|.||:|||..||||||
  Rat   183 ELRSDEECRQVYPGK---ITANMLCAGTKEGGKDSCEGDSGGPLICNGKLYGIISWGDFPCGQPN 244

  Fly   245 SPSVYVQVSSFITWI 259
            .|.||.:||.::.||
  Rat   245 RPGVYTRVSKYLRWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 74/234 (32%)
Tryp_SPc 32..262 CDD:238113 76/235 (32%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.