DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and TMPRSS11E

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:248 Identity:75/248 - (30%)
Similarity:111/248 - (44%) Gaps:36/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCL------ANRNQVLGSTLVAGS 89
            |:|||........|:..|:|:.|:|.|.|.:||:.|||:||||.      |......|.|:    
Human   191 RIVGGTEVEEGEWPWQASLQWDGSHRCGATLINATWLVSAAHCFTTYKNPARWTASFGVTI---- 251

  Fly    90 IAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSG--VRPTGK 152
                  ..:..||.:...::::.|...:..|||.|....:...:|.||..|.||.:.  .:|...
Human   252 ------KPSKMKRGLRRIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPDASYEFQPGDV 310

  Fly   153 ADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQ---DVHTTN-LCTGPLTGGTS 213
            ..:.|:|:   ..:..|.:.......:.:|...:|     ::.|   |..|.. ||.|.|.|.|.
Human   311 MFVTGFGA---LKNDGYSQNHLRQAQVTLIDATTC-----NEPQAYNDAITPRMLCAGSLEGKTD 367

  Fly   214 FCTSDSGGPLVQGNV-----LIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAA 261
            .|..|||||||..:.     |.||||||. .|.:||.|.||.:|::...||.:
Human   368 ACQGDSGGPLVSSDARDIWYLAGIVSWGD-ECAKPNKPGVYTRVTALRDWITS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 73/244 (30%)
Tryp_SPc 32..262 CDD:238113 74/247 (30%)
TMPRSS11ENP_054777.2 SEA 51..156 CDD:307516
Tryp_SPc 192..420 CDD:238113 74/247 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.