DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Tmprss5

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:236 Identity:80/236 - (33%)
Similarity:121/236 - (51%) Gaps:11/236 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLAN-RNQVLGSTLVAGSIAVAG 94
            |:|||:|.|:...|:..|:..|..|.|.|:::...|:||||||:.: |...|.|..|...:....
  Rat   207 RIVGGQAVASGRWPWQASVMLGSRHTCGASVLAPYWVVTAAHCMYSFRLSRLSSWRVHAGLVSHS 271

  Fly    95 TASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVR-PTG-KADLFG 157
            .....|...:...:.:.||:.....||:.|:...|...::..|:.|.||:.... |.| :..:.|
  Rat   272 AVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVSAVCLPAKEQHFPQGSQCWVSG 336

  Fly   158 WGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGP 222
            ||.|..:::.| ..|||:.. :|::|.|.|.::....|...|.. ||.|.|.|....|..|||||
  Rat   337 WGHTDPSHTHS-SDTLQDTM-VPLLSTDLCNSSCMYSGALTHRM-LCAGYLDGRADACQGDSGGP 398

  Fly   223 LV--QGNV--LIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            ||  .|:.  |:|:||||: .|.:||.|.||.:|:.|:.||
  Rat   399 LVCPSGDTWHLVGVVSWGR-GCAEPNRPGVYAKVAEFLDWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 78/234 (33%)
Tryp_SPc 32..262 CDD:238113 79/235 (34%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055
Tryp_SPc 208..441 CDD:238113 79/235 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.