DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and KLK13

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:277 Identity:91/277 - (32%)
Similarity:129/277 - (46%) Gaps:25/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVC--VSQGSGLALDQ--PEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANI 61
            ||....:...|.||:.  |||.|...|:.  ..|.:.||.....:|.|:..::...|...|...:
Human     1 MWPLALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLLCGGVL 65

  Fly    62 INSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLY----TGGTVPYDI 122
            ::..|::||||||..     |..:..|..|:....:..|.|::.|.:.:..|    |.....:||
Human    66 VHPKWVLTAAHCLKE-----GLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDI 125

  Fly   123 GL--IYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSP--SYPKTLQEAKNIPIIS 183
            .|  :.:|...|......|:. .::.:.|.....:.|||:|:   ||  :||||||.| ||.:.|
Human   126 MLLELQSPVQLTGYIQTLPLS-HNNRLTPGTTCRVSGWGTTT---SPQVNYPKTLQCA-NIQLRS 185

  Fly   184 LDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSV 248
            .:.|......|..|   ..||.|...||...|..|||||||....|.||||||..|||||:.|.|
Human   186 DEECRQVYPGKITD---NMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGV 247

  Fly   249 YVQVSSFITWIAANQKK 265
            |.:||.::.||....:|
Human   248 YTRVSRYVLWIRETIRK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 77/235 (33%)
Tryp_SPc 32..262 CDD:238113 79/237 (33%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.