DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk1c2

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:296 Identity:87/296 - (29%)
Similarity:122/296 - (41%) Gaps:70/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSN 65
            ||       :.:|::.:|.|...|....:.|:|||.....||.|:.|::.  ..:.|...:|:.:
  Rat     1 MW-------LQILSLVLSVGRIDAAPPGQSRIVGGYKCEKNSQPWQVAVI--NEYLCGGVLIDPS 56

  Fly    66 WLVTAAHCLANRNQVL-------------GSTLVAGS------IAVAGTASTTQKRQITHYVIND 111
            |::|||||.:|..|||             ...||..|      |.:..|..|.|.   .|...||
  Rat    57 WVITAAHCYSNNYQVLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQP---VHDHSND 118

  Fly   112 L----------YTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNS 166
            |          .|||....|:                |.|.|..|  .|..|.  |||||    :
  Rat   119 LMLLHLSEPADITGGVKVIDL----------------PTKEPKVG--STCLAS--GWGST----N 159

  Fly   167 PSYPKTLQEAK--NIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVL 229
            ||......:.:  ||.::|.:.|.........||   .||.|.:.||...|..||||||:...||
  Rat   160 PSEMVVSHDLQCVNIHLLSNEKCIETYKDNVTDV---MLCAGEMEGGKDTCAGDSGGPLICDGVL 221

  Fly   230 IGIVSWGKLPCGQPNSPSVYVQVSSFITWIAANQKK 265
            .||.|.|..||.:|.:|::|.::..|.:||....|:
  Rat   222 QGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 78/258 (30%)
Tryp_SPc 32..262 CDD:238113 79/260 (30%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 78/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.