DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk1b3

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:278 Identity:84/278 - (30%)
Similarity:120/278 - (43%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSN 65
            ||       .|:|.:.:|.|...|....:.|||||.....||.|:.|::.|.|.:.|...:|:.:
  Rat     5 MW-------FLILFLALSLGRNDAAPPVQSRVVGGYNCEMNSQPWQVAVYYFGEYLCGGVLIDPS 62

  Fly    66 WLVTAAHCLANRNQV-LGSTLVAGSIAVAGTASTTQKRQITHYVIN-DL------YTGGTVPYDI 122
            |::|||||..:..|| ||...:......|.....:|  ...|...| ||      ..|.....|:
  Rat    63 WVITAAHCATDNYQVWLGRNNLYEDEPFAQHRLVSQ--SFPHPGFNQDLIWNHTRQPGDDYSNDL 125

  Fly   123 GLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQ-----EAKNIPII 182
            .|::.......|..|..:.||....:........||||.:       |..|:     :..||.::
  Rat   126 MLLHLSQPADITDGVKVIDLPIEEPKVGSTCLASGWGSIT-------PDGLELSDDLQCVNIDLL 183

  Fly   183 SLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPS 247
            |.:.|..|   ..::|....||.|.:.||...|..||||||:...||.||.|||..|||:|..|.
  Rat   184 SNEKCVEA---HKEEVTDLMLCAGEMDGGKDTCKGDSGGPLICNGVLQGITSWGFNPCGEPKKPG 245

  Fly   248 VYVQVSSFITWIAANQKK 265
            :|.::..|..||....|:
  Rat   246 IYTKLIKFTPWIKEVMKE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 74/240 (31%)
Tryp_SPc 32..262 CDD:238113 75/242 (31%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 74/240 (31%)
Tryp_SPc 29..260 CDD:238113 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.