DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk1

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_036725.1 Gene:Klk1 / 24523 RGDID:2969 Length:261 Species:Rattus norvegicus


Alignment Length:278 Identity:88/278 - (31%)
Similarity:126/278 - (45%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHY-CAANIINS 64
            ||       .|:|.:.:|.|...|....:.||:||.....||.|:.|:: |..|.| |...:|:.
  Rat     1 MW-------FLILFLDLSLGQIDAAPPGQSRVIGGYKCEKNSQPWQVAL-YSFTKYLCGGVLIDP 57

  Fly    65 NWLVTAAHCLANRNQV-LGSTLVAGSIAVAGTASTTQKRQITHYVINDLY-----------TGGT 117
            :|::|||||.:|..|| ||...:......|      |.|.::....:..|           .|..
  Rat    58 SWVITAAHCSSNNYQVWLGRNNLLEDEPFA------QHRLVSQSFPHPDYKPFLMRNHTRKPGDD 116

  Fly   118 VPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPII 182
            ...|:.|::.......|..|..:.||:...:........||||| |.....:|..|| ..||.::
  Rat   117 HSNDLMLLHLSQPADITDGVKVIDLPTEEPKVGSTCLASGWGST-KPLIWEFPDDLQ-CVNIHLL 179

  Fly   183 SLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPS 247
            |.:.|..|...|..|:   .||.|.|.||...||.||||||:...||.||.|||.:||.:.|.|:
  Rat   180 SNEKCIKAYKEKVTDL---MLCAGELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPCAKTNMPA 241

  Fly   248 VYVQVSSFITWIAANQKK 265
            :|.::..|.:||....|:
  Rat   242 IYTKLIKFTSWIKEVMKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 78/240 (33%)
Tryp_SPc 32..262 CDD:238113 79/242 (33%)
Klk1NP_036725.1 Tryp_SPc 24..253 CDD:214473 78/240 (33%)
Tryp_SPc 25..256 CDD:238113 79/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.