DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Prss58

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_778185.1 Gene:Prss58 / 232717 MGIID:3608323 Length:241 Species:Mus musculus


Alignment Length:231 Identity:61/231 - (26%)
Similarity:93/231 - (40%) Gaps:20/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AANSAPYIVSMQYGGTHY--CAANIINSNWLVTAAHC-LANRNQVLGSTLVAGSIAVAGTASTTQ 100
            |..:.||:|   |..:.|  |...:|:..|::||||| |.|...:||.|..|..:......|..:
Mouse    24 AGTTPPYLV---YLKSDYLPCTGVLIHPLWVITAAHCNLPNLQVILGITNPADPMERDVEVSDYE 85

  Fly   101 KRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGST--SK 163
            |  |.|:. |.|.:  ::.:|:.||........:.....||||...|.......:..|...  ..
Mouse    86 K--IFHHP-NFLVS--SISHDLLLIKLKRRIKHSNYAKAVKLPQHIVSVNAMCSVSTWAYNLCDV 145

  Fly   164 TNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNV 228
            |..|...:|:    |:.:||...|..|.  |..|:....:|.|.:.|....|...:..|.|...|
Mouse   146 TKDPDSLQTV----NVTVISKAECRNAY--KAFDITENMICVGIVPGRRLPCKEVTAAPAVCNGV 204

  Fly   229 LIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAANQK 264
            |.||:|:.. .|.......:|..:..::.||....|
Mouse   205 LYGILSYAD-GCVLRADVGIYASIFHYLPWIEDTMK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 58/224 (26%)
Tryp_SPc 32..262 CDD:238113 60/227 (26%)
Prss58NP_778185.1 Tryp_SPc 29..237 CDD:238113 59/222 (27%)
Tryp_SPc 29..234 CDD:214473 57/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.