DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and PRSS54

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:275 Identity:60/275 - (21%)
Similarity:103/275 - (37%) Gaps:81/275 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DQPEGRVVGGKAAAANSAPYIVSM---QYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVA 87
            |..||.|      ::...|::||:   ||  ||.....|::..|:::.|..:.||..:       
Human    42 DPKEGLV------SSMEFPWVVSLQDSQY--THLAFGCILSEFWVLSIASAIQNRKDI------- 91

  Fly    88 GSIAVAGTASTTQKRQITH--YVINDL-----YTGGTVPYDIGLIYTPTAFTWTAAV-------- 137
              :.:.| .|.....:|.|  |.:|.:     :...::..:|.|:.|.||..:...|        
Human    92 --VVIVG-ISNMDPSKIAHTEYPVNTIIIHEDFDNNSMSNNIALLKTDTAMHFGNLVQSICFLGR 153

  Fly   138 ---APVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSC------AAALGS 193
               .|..|.:..|.        ||..||.|.:   ..|:...:.|.:..||.|      ....||
Human   154 MLHTPPVLQNCWVS--------GWNPTSATGN---HMTMSVLRKIFVKDLDMCPLYKLQKTECGS 207

  Fly   194 KGQDVHTTNLCTGPLTGGTSFCTSDSGGPLV----QGN--VLIGIVSWGKLPCGQPNSPS--VYV 250
            ..:: .|...|.|           |.|.|::    |.:  ||.|::::|...|     |.  :|.
Human   208 HTKE-ETKTACLG-----------DPGSPMMCQLQQFDLWVLRGVLNFGGETC-----PGLFLYT 255

  Fly   251 QVSSFITWIAANQKK 265
            :|..:..||.:..::
Human   256 KVEDYSKWITSKAER 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 55/262 (21%)
Tryp_SPc 32..262 CDD:238113 57/264 (22%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 54/251 (22%)
Tryp_SPc 52..264 CDD:238113 54/251 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.