DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Tmprss4

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:243 Identity:81/243 - (33%)
Similarity:120/243 - (49%) Gaps:15/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLV 86
            |.:|..|  |||||..|..:|.|:.||:||...|.|..:|::.:|::|||||......|....:.
Mouse   195 GKSLKTP--RVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVR 257

  Fly    87 AGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSG--VRP 149
            ||| .:.|.:.:....:|.....|.||   ....||.|:......|::.:|.|:.||.|.  :.|
Mouse   258 AGS-NILGNSPSLPVAKIFIAEPNPLY---PKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVP 318

  Fly   150 TGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSF 214
            .....:.|||.|.:.........||  .::.:|....|.|....:| :|....||.|...||...
Mouse   319 ATPVWVIGWGFTEENGGKMSDMLLQ--ASVQVIDSTRCNAEDAYEG-EVTAEMLCAGTPQGGKDT 380

  Fly   215 CTSDSGGPLVQGN---VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            |..||||||:..:   .::||||||. .||.|::|.||.:|::::.||
Mouse   381 CQGDSGGPLMYHSDKWQVVGIVSWGH-GCGGPSTPGVYTKVTAYLNWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 76/232 (33%)
Tryp_SPc 32..262 CDD:238113 77/233 (33%)
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060
SRCR_2 106..195 CDD:295335 81/243 (33%)
Tryp_SPc 202..427 CDD:214473 76/232 (33%)
Tryp_SPc 203..430 CDD:238113 77/233 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.