DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and St14

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:283 Identity:87/283 - (30%)
Similarity:128/283 - (45%) Gaps:49/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VCVSQGS--------------------GLALDQPEGRVVGGKAAAANSAPYIVSMQ-YGGTHYCA 58
            :|:|:|:                    ||.....:.|||||..|.....|:.||:. .|..|.|.
Mouse   598 LCLSKGNPECDGKTDCSDGSDEKNCDCGLRSFTKQARVVGGTNADEGEWPWQVSLHALGQGHLCG 662

  Fly    59 ANIINSNWLVTAAHCLANRNQVLGS-----TLVAGSI-----AVAGTASTTQKRQITHYVINDLY 113
            |::|:.:|||:||||..:......|     |...|.:     :.:|......||.|||...||. 
Mouse   663 ASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAFLGLLDQSKRSASGVQELKLKRIITHPSFNDF- 726

  Fly   114 TGGTVPYDIGLIYTPTAFTWTAAVAPVKLP-SSGVRPTGKAD-LFGWGSTSKTNSPSYPKTLQEA 176
               |..|||.|:....:..::..|.|:.|| ::.|.|.|||. :.|||.|.:..:.:.  .||:.
Mouse   727 ---TFDYDIALLELEKSVEYSTVVRPICLPDATHVFPAGKAIWVTGWGHTKEGGTGAL--ILQKG 786

  Fly   177 KNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPL----VQGNVL-IGIVSWG 236
            : |.:|:..:|...:   .|.:....:|.|.|:||...|..||||||    ..|.:. .|:||||
Mouse   787 E-IRVINQTTCEDLM---PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSAEKDGRMFQAGVVSWG 847

  Fly   237 KLPCGQPNSPSVYVQVSSFITWI 259
            : .|.|.|.|.||.::.....||
Mouse   848 E-GCAQRNKPGVYTRLPVVRDWI 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 80/245 (33%)
Tryp_SPc 32..262 CDD:238113 81/246 (33%)
St14XP_036010597.1 SEA 108..198 CDD:396113
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060
LDLa 587..622 CDD:238060 3/23 (13%)
Tryp_SPc 635..872 CDD:238113 81/246 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.