DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk1b3

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_032719.1 Gene:Klk1b3 / 18050 MGIID:97322 Length:261 Species:Mus musculus


Alignment Length:283 Identity:86/283 - (30%)
Similarity:125/283 - (44%) Gaps:42/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHY-CAANIINS 64
            ||       .|:|.:.:|.|...|....:.|:|||.....||.|:.|:: |..|.| |...:::.
Mouse     1 MW-------FLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWHVAV-YRYTQYLCGGVLLDP 57

  Fly    65 NWLVTAAHCLANRNQV-LGST------------LVAGSIAVAGTASTTQKRQI---THYVINDL- 112
            ||::|||||..:..:| ||..            .|:.:|...|...:..::.|   .:...||| 
Mouse    58 NWVLTAAHCYDDNYKVWLGKNNLFKDEPSAQHRFVSKAIPHPGFNMSLMRKHIRFLEYDYSNDLM 122

  Fly   113 YTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAK 177
            ....:.|.||           |..|.|:.||:...:........||||.:.|.. .:...|. ..
Mouse   123 LLRLSKPADI-----------TDTVKPITLPTEEPKLGSTCLASGWGSITPTKF-QFTDDLY-CV 174

  Fly   178 NIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQ 242
            |:.::..:.||.|...|..|   ..||.|.:.||...|..||||||:...||.||.|||..|||:
Mouse   175 NLKLLPNEDCAKAHIEKVTD---AMLCAGEMDGGKDTCKGDSGGPLICDGVLQGITSWGHTPCGE 236

  Fly   243 PNSPSVYVQVSSFITWIAANQKK 265
            |:.|.||.:::.|.:||.....|
Mouse   237 PDMPGVYTKLNKFTSWIKDTMAK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 76/245 (31%)
Tryp_SPc 32..262 CDD:238113 77/247 (31%)
Klk1b3NP_032719.1 Tryp_SPc 25..256 CDD:238113 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.