DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk1b4

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:286 Identity:81/286 - (28%)
Similarity:121/286 - (42%) Gaps:65/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSN 65
            ||       .|:|.:.:|.| |:....|    |..:....||.|:.|::.....:.|...:::.|
Mouse     1 MW-------FLILFLALSLG-GIDAAPP----VQSQVDCENSQPWHVAVYRFNKYQCGGVLLDRN 53

  Fly    66 WLVTAAHCLANRNQV-LGST------------LVAGSIAVAGTASTTQKRQITHYVIN------- 110
            |::|||||..::.|| ||..            ||:              :.|.|...|       
Mouse    54 WVLTAAHCYNDKYQVWLGKNNFLEDEPSDQHRLVS--------------KAIPHPDFNMSLLNEH 104

  Fly   111 -----DLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYP 170
                 |.|:.     |:.|:........|..|.|:.||:...:........|||||:.... .||
Mouse   105 TPQPEDDYSN-----DLMLLRLSKPADITDVVKPITLPTEEPKLGSTCLASGWGSTTPIKF-KYP 163

  Fly   171 KTLQEAKNIPIISLDSCAAALGSKGQDVHTTN--LCTGPLTGGTSFCTSDSGGPLVQGNVLIGIV 233
            ..|| ..|:.::..:.|     .|..::..|:  ||.|.:.||:..|..||||||:...:|.||.
Mouse   164 DDLQ-CVNLKLLPNEDC-----DKAHEMKVTDAMLCAGEMDGGSYTCEHDSGGPLICDGILQGIT 222

  Fly   234 SWGKLPCGQPNSPSVYVQVSSFITWI 259
            |||..|||:|..||||.::..|.:||
Mouse   223 SWGPEPCGEPTEPSVYTKLIKFSSWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 71/254 (28%)
Tryp_SPc 32..262 CDD:238113 73/255 (29%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 76/267 (28%)
Activation peptide homolog 18..24 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.