DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk1b24

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_034773.1 Gene:Klk1b24 / 16617 MGIID:892021 Length:263 Species:Mus musculus


Alignment Length:275 Identity:83/275 - (30%)
Similarity:121/275 - (44%) Gaps:24/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSN 65
            ||       .|:|.:.:|.|...|....:.|||||.....||.|:.|::.....:.|...::|.|
Mouse     1 MW-------FLILFLALSLGGIDAAPPVQSRVVGGFKCEKNSQPWHVAVFRYNKYICGGVLLNPN 58

  Fly    66 WLVTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQIT----HYVINDLYTGGTVPY------ 120
            |::|||||..|........|  |...:.....:.|.|.::    |...|.......:|.      
Mouse    59 WVLTAAHCYGNATSQYNVWL--GKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDDIPQPKDKSN 121

  Fly   121 DIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLD 185
            |:.|:........|.||.|:.||:...:........||||.:.|.... |..|| ...|.::..:
Mouse   122 DLMLLRLSEPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKWQK-PNDLQ-CVFIKLLPNE 184

  Fly   186 SCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYV 250
            :|......|..||   .||.|.:.||...|..||||||:...:|.||.|||.:|||:||:|::|.
Mouse   185 NCTKPYLHKVTDV---MLCAGEMGGGKDTCAGDSGGPLICDGILHGITSWGPVPCGKPNAPAIYT 246

  Fly   251 QVSSFITWIAANQKK 265
            ::..|.:||.....|
Mouse   247 KLIKFASWIKDTMAK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 73/237 (31%)
Tryp_SPc 32..262 CDD:238113 74/239 (31%)
Klk1b24NP_034773.1 Tryp_SPc 24..255 CDD:214473 73/237 (31%)
Tryp_SPc 25..258 CDD:238113 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.