DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk1b21

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011249110.1 Gene:Klk1b21 / 16616 MGIID:892022 Length:296 Species:Mus musculus


Alignment Length:296 Identity:82/296 - (27%)
Similarity:122/296 - (41%) Gaps:46/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLA 75
            |:|.:.:|.|...|....:.|:|||.....||.|:.|::.....:.|...::|.||::|||||..
Mouse     4 LILFLALSLGEIDAAPPVQSRIVGGFNCEKNSQPWHVAVFRYNKYICGGVLLNPNWVLTAAHCYG 68

  Fly    76 NRNQVLGSTLVAGSIAVAGTASTTQKRQIT----HYVINDLYTGGTVPY-------DIGLIYTPT 129
            |........|  |...:....|:.|.|.::    |...|........|:       |:.|:....
Mouse    69 NATSQYNVWL--GKNKLFQHESSAQHRLVSKSFPHPDYNMSLMNDHTPHPEDDYSNDLMLLRLSK 131

  Fly   130 AFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKN---------------- 178
            ....|.||.|:.||:...:........||||.:.|...|.|:.:...:.                
Mouse   132 PADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKCESAPRNIARCRGGAEGPGLGPVHHPLSL 196

  Fly   179 --------------IPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVL 229
                          |..:..::||.|...|..||   .||.|.:.||...|..||||||:...||
Mouse   197 SSTGQIPNDLQCGFIKPLPNENCAKAYIHKVTDV---MLCAGEMGGGKDTCAGDSGGPLICDGVL 258

  Fly   230 IGIVSWGKLPCGQPNSPSVYVQVSSFITWIAANQKK 265
            .||.|||.:||.:||:|::|.::..|.:||.....|
Mouse   259 QGITSWGSIPCAKPNAPAIYTKLIKFTSWIKDTMAK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 74/268 (28%)
Tryp_SPc 32..262 CDD:238113 75/270 (28%)
Klk1b21XP_011249110.1 Tryp_SPc 25..291 CDD:238113 75/270 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.