DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk1b11

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_034770.1 Gene:Klk1b11 / 16613 MGIID:892023 Length:261 Species:Mus musculus


Alignment Length:277 Identity:83/277 - (29%)
Similarity:125/277 - (45%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSN 65
            ||       .|:|.:.:|.|...|....:.|:|||.....||.|:.|::.....:.|...:::.|
Mouse     1 MW-------FLILFLALSLGGIDAAPPVQSRIVGGFNCEKNSQPWHVAVYRYNKYICGGVLLDRN 58

  Fly    66 WLVTAAHC-LANRNQVLGSTLVAGSIAVAGTASTTQKRQIT------HYVINDLYTGGTVP---- 119
            |::||||| ::..|..||.|      .:.....:.|.|.::      .|.::.|......|    
Mouse    59 WVLTAAHCHVSQYNVWLGKT------KLFQREPSAQHRMVSKSFPHPDYNMSLLIIHNPEPEDDE 117

  Fly   120 -YDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIIS 183
             .|:.|:........|.||.|:.||:...:......:.||||.:.|...: |..|| ..:|.::.
Mouse   118 SNDLMLLRLSEPADITDAVKPIALPTEEPKLGSTCLVSGWGSITPTKFQT-PDDLQ-CVSIKLLP 180

  Fly   184 LDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSV 248
            .:.|......|..||   .||.|.:.||...|..||||||:...||.||.:||.:|||:||:|.|
Mouse   181 NEVCVKNHNQKVTDV---MLCAGEMGGGKDTCKGDSGGPLICDGVLHGITAWGPIPCGKPNTPGV 242

  Fly   249 YVQVSSFITWIAANQKK 265
            |.::..|..||.....|
Mouse   243 YTKLIKFTNWIKDTMAK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 73/239 (31%)
Tryp_SPc 32..262 CDD:238113 74/241 (31%)
Klk1b11NP_034770.1 Tryp_SPc 24..253 CDD:214473 73/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.