DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:271 Identity:79/271 - (29%)
Similarity:112/271 - (41%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLV--- 86
            |..|..|:|||..::....|:..|:|..|.|.|...:|...|::|||||.  :...:.||::   
Human   561 LQGPSSRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADRWVITAAHCF--QEDSMASTVLWTV 623

  Fly    87 -AGSI----AVAGTASTTQKRQITH-YVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPS- 144
             .|.:    ...|..|....|.:.| |...|.:     .||:.|:........:|||.||.||: 
Human   624 FLGKVWQNSRWPGEVSFKVSRLLLHPYHEEDSH-----DYDVALLQLDHPVVRSAAVRPVCLPAR 683

  Fly   145 --------------------SGVRPTGKADLFGW-GSTSKTNSPSYPKTLQEAKNIPIISLDSCA 188
                                ..:|....|..:|| ...|:|........||:. ::.:|..|.|:
Human   684 SHFFEPGLHCWITGWGALREGALRADAVALFYGWRNQGSETCCCPISNALQKV-DVQLIPQDLCS 747

  Fly   189 AALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLV----QGN-VLIGIVSWGKLPCGQPNSPSV 248
            ...   ...|....||.|...|....|..|||||||    .|. .|.|:|||| |.||:||...|
Human   748 EVY---RYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKALSGRWFLAGLVSWG-LGCGRPNYFGV 808

  Fly   249 YVQVSSFITWI 259
            |.:::..|:||
Human   809 YTRITGVISWI 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 75/263 (29%)
Tryp_SPc 32..262 CDD:238113 76/264 (29%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486
Tryp_SPc 568..822 CDD:238113 76/264 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.