DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and PRSS36

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:286 Identity:77/286 - (26%)
Similarity:123/286 - (43%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RHLATILLLAVC-----VSQGSGLA--------LD----QPEGRVVGGKAAAANSAPYIVSMQYG 52
            |||...|::.|.     ..|.|.|:        ||    :|..|:|||..|...:.|:.||:.:|
Human     3 RHLLLPLVMLVISPIPGAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNAQPGTWPWQVSLHHG 67

  Fly    53 GTHYCAANIINSNWLVTAAHCLANRNQVLGS---TLVAGSIAVAGTASTTQKRQITHYVINDLYT 114
            |.|.|..::|..:|:::||||......:..:   :::.|..:..|.......|.:...|:...|:
Human    68 GGHICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYS 132

  Fly   115 GGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLF--GWGSTSKTNSPSYPKTLQEAK 177
            ...:..|:.|:...:..:...||.||.||.:..|.......:  |||...:.:....|..|||.:
Human   133 QVELGADLALLRLASPASLGPAVWPVCLPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEVE 197

  Fly   178 NIPIISLDSCAAALGSKGQ-----DVHTTNLCTGPLTGGTSFCTSDSGGPLV--QGN--VLIGIV 233
             :.::...:|.......|.     .:....||.|...|....|..|||||||  :|.  ...||.
Human   198 -LRLLGEATCQCLYSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGIT 261

  Fly   234 SWGKLPCGQPNSPSVYVQVSSFITWI 259
            |:| ..||:.|.|.|:..|:::..||
Human   262 SFG-FGCGRRNRPGVFTAVATYEAWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 64/241 (27%)
Tryp_SPc 32..262 CDD:238113 65/242 (27%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 64/241 (27%)
Tryp_SPc 47..289 CDD:238113 65/242 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.