DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and PRSS58

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001001317.1 Gene:PRSS58 / 136541 HGNCID:39125 Length:241 Species:Homo sapiens


Alignment Length:227 Identity:60/227 - (26%)
Similarity:96/227 - (42%) Gaps:24/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ANSAPYIVSMQYGGTHY--CAANIINSNWLVTAAHC-LANRNQVLGSTLVAGS----IAVAGTAS 97
            :::.||:|   |..:.|  ||..:|:..|::||||| |.....:||.|:.|.|    :.|.|   
Human    25 SSTPPYLV---YLKSDYLPCAGVLIHPLWVITAAHCNLPKLRVILGVTIPADSNEKHLQVIG--- 83

  Fly    98 TTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTS 162
              .::.|.|    ..::..::.:||.||...|.......|....||...:.......:..| |.:
Human    84 --YEKMIHH----PHFSVTSIDHDIMLIKLKTEAELNDYVKLANLPYQTISENTMCSVSTW-SYN 141

  Fly   163 KTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGN 227
            ..:....|.:||.. ||.:||...|..|.  |..::....||.|.:.|....|...|..|.:...
Human   142 VCDIYKEPDSLQTV-NISVISKPQCRDAY--KTYNITENMLCVGIVPGRRQPCKEVSAAPAICNG 203

  Fly   228 VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            :|.||:|:.. .|.......:|.::..:|.||
Human   204 MLQGILSFAD-GCVLRADVGIYAKIFYYIPWI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 58/225 (26%)
Tryp_SPc 32..262 CDD:238113 60/227 (26%)
PRSS58NP_001001317.1 Tryp_SPc 29..234 CDD:214473 58/221 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.