DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and LOC1276790

DIOPT Version :10

Sequence 1:NP_609551.2 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_316180.5 Gene:LOC1276790 / 1276790 VectorBaseID:AGAMI1_013002 Length:896 Species:Anopheles gambiae


Alignment Length:70 Identity:18/70 - (25%)
Similarity:30/70 - (42%) Gaps:20/70 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PADAKPLTGRDLANKHKTDGNAHFRVGKYDL-AIREYDAAIEHCPTYEATDRATYYQNRAAAYEQ 135
            |.|:||: .|.:.:.|...|.|.:.|.|.|. .|:|.:|                  .:||.|.:
Mosquito    71 PCDSKPV-NRCILDSHCGKGVAFYFVCKSDCELIKENEA------------------RQAAGYAR 116

  Fly   136 LQNWA 140
            |.:::
Mosquito   117 LLSFS 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_609551.2 Tryp_SPc 32..262 CDD:238113 18/70 (26%)
LOC1276790XP_316180.5 None

Return to query results.
Submit another query.