DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and St14

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_446087.1 Gene:St14 / 114093 RGDID:69288 Length:855 Species:Rattus norvegicus


Alignment Length:268 Identity:88/268 - (32%)
Similarity:122/268 - (45%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQGS-------GLALDQPEGRVVGGKAAAANSAPYIVSMQ-YGGTHYCAANIINSNWLVTAAHCL 74
            |.||       ||.....:.|||||..|.....|:.||:. .|..|.|.|::|:.:|||:||||.
  Rat   594 SDGSDEKNCDCGLRSFTKQARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCF 658

  Fly    75 ANR-----------NQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTP 128
            .:.           ...|| .|.....:.:|......||.|||...||.    |..|||.|:...
  Rat   659 QDETIFKYSDHTMWTAFLG-LLDQSKRSASGVQEHKLKRIITHPSFNDF----TFDYDIALLELE 718

  Fly   129 TAFTWTAAVAPVKLP-SSGVRPTGKAD-LFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAAL 191
            ....::..|.|:.|| ::.|.|.|||. :.|||.|.:..:.:.  .||:.: |.:|:..:|...|
  Rat   719 KPAEYSTVVRPICLPDNTHVFPAGKAIWVTGWGHTKEGGTGAL--ILQKGE-IRVINQTTCEELL 780

  Fly   192 GSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPL----VQGNVL-IGIVSWGKLPCGQPNSPSVYVQ 251
               .|.:....:|.|.|:||...|..||||||    ..|.:. .|:||||: .|.|.|.|.||.:
  Rat   781 ---PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEKDGRIFQAGVVSWGE-GCAQRNKPGVYTR 841

  Fly   252 VSSFITWI 259
            :.....||
  Rat   842 IPEVRDWI 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 81/246 (33%)
Tryp_SPc 32..262 CDD:238113 82/247 (33%)
St14NP_446087.1 SEA 88..178 CDD:396113
CUB 214..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 492..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060 3/7 (43%)
Tryp_SPc 615..852 CDD:238113 82/247 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.