DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and KLK8

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:242 Identity:65/242 - (26%)
Similarity:105/242 - (43%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVA 93
            |.:|:||.....:|.|:..::..|....|...::..||::|||||...:     .|:..|..::.
Human    75 EDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPK-----YTVRLGDHSLQ 134

  Fly    94 GTASTTQKRQITHYVINDLYTGGTVP---YDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADL 155
            ......|:..:...:.:..|....|.   :|:.|:......:..:.|.|:.|.....:|..|..:
Human   135 NKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTV 199

  Fly   156 FGWGSTSKTNSP--SYPKTLQ--EAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTS--- 213
            .|||:.:   ||  ::|.||.  |.|..|           ..|.:|.:...:..|.:..|:|   
Human   200 SGWGTVT---SPRENFPDTLNCAEVKIFP-----------QKKCEDAYPGQITDGMVCAGSSKGA 250

  Fly   214 -FCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
             .|..|||||||....|.||.|||..|||:.:.|.||..:..::.||
Human   251 DTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 62/238 (26%)
Tryp_SPc 32..262 CDD:238113 64/239 (27%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 62/238 (26%)
Tryp_SPc 78..300 CDD:238113 64/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.