DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and LOC101732100

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_031749505.1 Gene:LOC101732100 / 101732100 -ID:- Length:327 Species:Xenopus tropicalis


Alignment Length:261 Identity:81/261 - (31%)
Similarity:127/261 - (48%) Gaps:22/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLAVCVSQ---GSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHC 73
            |..:|.::   |..:|:..   |:|||:.|.....|:...:...|.:.|...:::|.|:|:||||
 Frog    17 LYTICEAEKACGKSVAISD---RIVGGQDAKKGKYPWQALLWCPGVYRCGGTLVSSKWVVSAAHC 78

  Fly    74 LANRNQVLGSTL--VAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAA 136
            |:..|   .|.|  :.|:..::|..:......:.:..|:..|....:..||||.....|.::|:.
 Frog    79 LSRSN---ASCLAVILGANKLSGNENEEMAVSVKNIYIHPNYNDTDITNDIGLAELTQAVSFTSY 140

  Fly   137 VAPVKLPSSGV--RPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVH 199
            |.||.||::..  .|.....:.|||.|....|.| |.||||.: :.|:|.:.|.:........|:
 Frog   141 VIPVCLPTASTIFNPGQSCWVTGWGVTEFNTSLS-PNTLQEVQ-MRILSAEQCRSYYDPNITGVY 203

  Fly   200 TTN--LCTGPLTGGTSFCTSDSGGPLV---QGN-VLIGIVSWGKLPCGQPNSPSVYVQVSSFITW 258
            .|:  :|...:.||...|..|||||||   .|| .|:|:||:| :.||....|.||..|.::..|
 Frog   204 ITDQMICARDILGGKDSCQGDSGGPLVCSYGGNFYLVGVVSFG-IGCGDTAYPGVYTYVPAYRDW 267

  Fly   259 I 259
            |
 Frog   268 I 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 75/237 (32%)
Tryp_SPc 32..262 CDD:238113 76/238 (32%)
LOC101732100XP_031749505.1 Tryp_SPc 37..268 CDD:238113 74/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.