DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and LOC100535114

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_009296342.3 Gene:LOC100535114 / 100535114 -ID:- Length:329 Species:Danio rerio


Alignment Length:307 Identity:88/307 - (28%)
Similarity:133/307 - (43%) Gaps:74/307 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALDQPE----------GRVVGGKAAAANSAPYIVSMQYGGTH 55
            ||  |....||||.:||..    :|.||:          .|:|||..|...|.|::||::..|.|
Zfish     1 MW--RKTCVILLLVMCVRD----SLSQPDVCGRPNPNFNPRIVGGVNATEGSWPWMVSLRKSGVH 59

  Fly    56 YCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGTAS-----------TTQKRQITHYVI 109
            :|..::||:.|::|||||::.:.                |:|           .|.:.:||..||
Zfish    60 FCGGSLINNQWVLTAAHCISGKT----------------TSSMHVYLGKWRRYETDQNEITRTVI 108

  Fly   110 NDL----YTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVR-PTG-KADLFGWG--------- 159
            :.:    |...|...||.|:.......:|..:.|:.|...... |.| ::.:.|||         
Zfish   109 DIIPHPSYNNRTSDNDIALLQLSATVQYTVYIKPICLADQNSNFPRGTRSWVTGWGRIGVSGTGG 173

  Fly   160 ----STSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTN-LCTGPLTGGTSFCTSDS 219
                :|.....|: |..|||.: :.:.|.:.|:    .:.|...|.| :|.|..:||......||
Zfish   174 ISGRTTVSVPLPA-PGILQEVE-LQVYSNEKCS----KRCQGPITPNMICAGTRSGGKGTFYGDS 232

  Fly   220 GGPLVQGN----VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAAN 262
            ||||:...    |..|:||.| ..|.||..|.|:::||.:..||..|
Zfish   233 GGPLMSKQCSVWVQAGVVSHG-YGCAQPKIPGVFIRVSEYKQWITDN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 73/262 (28%)
Tryp_SPc 32..262 CDD:238113 74/264 (28%)
LOC100535114XP_009296342.3 Tryp_SPc 36..278 CDD:238113 74/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.