DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and tmprss11f

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_004911133.1 Gene:tmprss11f / 100379970 XenbaseID:XB-GENE-1012399 Length:427 Species:Xenopus tropicalis


Alignment Length:248 Identity:86/248 - (34%)
Similarity:130/248 - (52%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLV 86
            |:.......|:|||..|...|.|:..|::..|:|.|.|:::|..|||.||||..........|:|
 Frog   187 GIGGPSVSNRIVGGTNAGLGSWPWQASLRLLGSHTCGASLLNDTWLVAAAHCFDMNADANSWTVV 251

  Fly    87 AGSIAV-AGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLP-SSGVRP 149
            .|:|.| :|:....:|     .:|.:.||......||.|:...|...:|:.:.||.|| :|.:.|
 Frog   252 LGTINVYSGSEFKIEK-----IIIYEGYTSHNHRNDIALLKLFTPLNFTSIIRPVCLPEASDIFP 311

  Fly   150 TGKA-DLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTS 213
            .|.: .:.|||:.  |:..|..:.||:|: :.||:.|:|::: ...|..::.:.:|.|..||...
 Frog   312 DGSSCYITGWGAL--TDGGSASQVLQQAE-VKIINSDTCSSS-QMYGGLIYPSMICAGYATGQID 372

  Fly   214 FCTSDSGGPLV---QGN-VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAAN 262
            .|..|||||||   .|. |||||||:| ..|..||.|.||.:::....||.|:
 Frog   373 SCQGDSGGPLVTLKSGRWVLIGIVSFG-YGCALPNKPGVYSRITYLRNWITAH 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 82/234 (35%)
Tryp_SPc 32..262 CDD:238113 83/236 (35%)
tmprss11fXP_004911133.1 SEA 48..148 CDD:396113
Tryp_SPc 197..421 CDD:238113 81/233 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.