DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and LOC100004427

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:281 Identity:79/281 - (28%)
Similarity:122/281 - (43%) Gaps:66/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQY--GGTHYCAANIINSNWLVTA 70
            |.:|.:|.|:.|...........::|||..|...|.|:..|:.:  .|..:|:.::|:..|::||
Zfish    12 AVLLNIAGCLGQSDVCGRAPLNTKIVGGLNATEGSWPWQASINFKSTGQFFCSGSLISERWVLTA 76

  Fly    71 AHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVI--NDLYTGGTVPY------------- 120
            |.|.                         |:..::..||  ..|.|.|:.||             
Zfish    77 ASCF-------------------------QRINVSDVVIYLGRLTTNGSNPYEIPRTVIQVSVTE 116

  Fly   121 DIGLIYTPTAFTWTAAVAPVKLPSSG---VRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPII 182
            ||.|:...::.|:|..:.||.|.::|   |..| ::.:.||||||.|| ......|:|.: .||:
Zfish   117 DIALVQLSSSVTFTDYIRPVCLAAAGSVFVDGT-ESWVTGWGSTSSTN-VILSDMLKEVE-APIV 178

  Fly   183 SLDSCAAALGSKGQDVHTTNL----CTGPLT-GGTSFCTSDSGGPLV--QGNVLI--GIVSWGKL 238
            :...|:...|       .|||    |.|.:. .|.:.|..|.|.|||  ||:..|  |:|.:  .
Zfish   179 NNIECSNING-------ITNLDNVICAGFVNETGKAPCWEDFGSPLVTRQGSQWIQSGVVVF--T 234

  Fly   239 PCGQPNSPSVYVQVSSFITWI 259
            .|||...|::|.:||.:..||
Zfish   235 FCGQNGFPTLYARVSEYEEWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 72/256 (28%)
Tryp_SPc 32..262 CDD:238113 74/257 (29%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 72/256 (28%)
Tryp_SPc 36..257 CDD:238113 74/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.