DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Tmprss5

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:242 Identity:85/242 - (35%)
Similarity:119/242 - (49%) Gaps:11/242 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSN-QVLGSTLVAGSIAVDG 98
            |:|||...|....|:..|:..|..|.|.||:|..:|:||||||:.:.. ..|.|..|...:...|
Mouse   217 RIVGGQAVASGRWPWQASVMLGSRHTCGASVLAPHWVVTAAHCMYSFRLSRLSSWRVHAGLVSHG 281

  Fly    99 TASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGV-VPTGT-ANLYG 161
            .....|...:...:.:.||:.....||:.::...|...:|..|..|.||:... .|.|: ..:.|
Mouse   282 AVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVGAVCLPAKEQHFPWGSQCWVSG 346

  Fly   162 WGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGP 226
            ||.|..::|.| ..||| .|.||::|...|.|:....|:..|.. ||.|.|.|....|..|||||
Mouse   347 WGHTDPSHTHS-SDTLQ-DTMVPLLSTYLCNSSCMYSGALTHRM-LCAGYLDGRADACQGDSGGP 408

  Fly   227 LV--QGNV--LIGIVSWGKLPCGQANSPSVYVQVSSFISWISANQQV 269
            ||  .|:.  |:|:||||: .|.:.|.|.||.:|:.|:.||....||
Mouse   409 LVCPSGDTWHLVGVVSWGR-GCAEPNRPGVYAKVAEFLDWIHDTVQV 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 81/234 (35%)
Tryp_SPc 36..266 CDD:238113 82/236 (35%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845
Tryp_SPc 217..448 CDD:214473 81/234 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.