DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Prss44

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:255 Identity:83/255 - (32%)
Similarity:109/255 - (42%) Gaps:37/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAG 92
            |.|....|:|||.||.....|:.||:|....|.|..|:::..|::|||||      |.|....| 
Mouse   104 ACGHRTARIVGGRPAPARKWPWQVSLQVHKQHICGGSLISKWWVITAAHC------VYGHLDYA- 161

  Fly    93 SIAVDGTASTTQTRSI-----TYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLP-SSGV 151
              ...|.|.....|.:     ...|..|.....||.:||.::.......:|..:.||.:| .|.:
Mouse   162 --VFMGDADLWSKRPVRIPVQDIIVHQDFSMMRTVVHDIALVLLAFPVNYSVNIQPVCIPEKSFL 224

  Fly   152 VPTGT-ANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGG 215
            |..|| ..:.|||.......:|  ..|| ...:.||....|...|    .|:.. |:.|....||
Mouse   225 VQPGTLCWVTGWGKVLEQGRSS--RILQ-EIELNIIRHEKCNQIL----KDIMG-NIFTLVQEGG 281

  Fly   216 V--------SICTSDSGGPLV-QGN---VLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263
            |        ..|..||||||| :.|   |.:|||||| |.||:...|.||.:||.:..||
Mouse   282 VCGYNEKGGDACQGDSGGPLVCEFNKTWVQVGIVSWG-LGCGRIGYPGVYTEVSYYRDWI 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 79/246 (32%)
Tryp_SPc 36..266 CDD:238113 80/247 (32%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 79/246 (32%)
Tryp_SPc 112..340 CDD:238113 78/245 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.