DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Tmprss6

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_082178.2 Gene:Tmprss6 / 71753 MGIID:1919003 Length:811 Species:Mus musculus


Alignment Length:257 Identity:75/257 - (29%)
Similarity:116/257 - (45%) Gaps:24/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLG 86
            |.:.|::     .|:|||:.::....|:..|:|..|.|.|..:::...|::|||||....:....
Mouse   568 CGLQGLS-----SRIVGGTVSSEGEWPWQASLQIRGRHICGGALIADRWVITAAHCFQEDSMASP 627

  Fly    87 S--TLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLP-- 147
            .  |:..|.:..:.......:..::...::..:...:..||:.::......|:||.|.||.||  
Mouse   628 KLWTVFLGKMRQNSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVRPVCLPAR 692

  Fly   148 SSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPL 212
            |....|.....:.|||:.......|  :||| ..:|.::....|..|...:   |....||.|..
Mouse   693 SHFFEPGQHCWITGWGAQREGGPVS--NTLQ-KVDVQLVPQDLCSEAYRYQ---VSPRMLCAGYR 751

  Fly   213 TGGVSICTSDSGGPLV----QGN-VLIGIVSWGKLPCGQANSPSVYVQVSSFISWISANQQV 269
            .|....|..|||||||    .|. .|.|:|||| |.||:.|...||.:|:..|:||   |||
Mouse   752 KGKKDACQGDSGGPLVCREPSGRWFLAGLVSWG-LGCGRPNFFGVYTRVTRVINWI---QQV 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 68/236 (29%)
Tryp_SPc 36..266 CDD:238113 69/238 (29%)
Tmprss6NP_082178.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 68/236 (29%)
Tryp_SPc 577..809 CDD:238113 70/241 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.