DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Klk13

DIOPT Version :10

Sequence 1:NP_609550.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001034131.2 Gene:Klk13 / 626834 MGIID:3615275 Length:276 Species:Mus musculus


Alignment Length:40 Identity:12/40 - (30%)
Similarity:18/40 - (45%) Gaps:8/40 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 RMYIFGGRSDAVAPYHSQEEIYCPNIKFLDLKADRWYTPK 230
            ||.|..|..:  |.:.:|..||.      .||.:.::|.|
Mouse   309 RMVIITGPPE--AQFKAQGRIYG------KLKEENFFTAK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_609550.1 Tryp_SPc 36..266 CDD:238113 12/40 (30%)
Klk13NP_001034131.2 Tryp_SPc 39..262 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.