DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and tmprss9

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_021325244.1 Gene:tmprss9 / 562051 ZFINID:ZDB-GENE-050208-573 Length:788 Species:Danio rerio


Alignment Length:236 Identity:86/236 - (36%)
Similarity:116/236 - (49%) Gaps:11/236 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVDGT 99
            |:|||........|:.||::..|.|.|.|||:|:.|||:||||....|.....|.:.|:..|.|.
Zfish   231 RIVGGENTRHGEFPWQVSLRLRGRHTCGASIVNSRWLVSAAHCFEVENNPKDWTALVGANQVSGA 295

  Fly   100 ASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTAN--LYGW 162
            .:.....:|...|::..|...|...|:.::...|...:|..|.||.:|||..|.|...|  :.||
Zfish   296 EAEAFIVNIKSLVMSPKYDPMTTDSDVTVLELETPLKFSHYVQPVCIPSSSHVFTPGQNCIVSGW 360

  Fly   163 GSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPL 227
            |:.: ..|...|||||.|. |.||....|..:...:|: :....:|.|.|.|.|..|..||||||
Zfish   361 GALN-QYTTEVPSTLQKAI-VKIIDSKVCNKSSVYRGA-LTQNMMCAGFLQGKVDSCQGDSGGPL 422

  Fly   228 ----VQGN-VLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263
                ..|. .|.|||||| :.|.|.|.|.||.:|:...:||
Zfish   423 ACEVAAGRYFLAGIVSWG-VGCAQINKPGVYSRVTKLRNWI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 84/234 (36%)
Tryp_SPc 36..266 CDD:238113 85/235 (36%)
tmprss9XP_021325244.1 SEA 52..146 CDD:307516
LDLa 185..220 CDD:238060
Tryp_SPc 232..462 CDD:238113 83/233 (36%)
LDLa 510..544 CDD:238060
Tryp_SPc 557..783 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.