DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Prss53

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:313 Identity:63/313 - (20%)
Similarity:117/313 - (37%) Gaps:72/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLLLGICRISGVAI----------GAP---EGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASIL 66
            ||::..:..|.|:..          |.|   ||..:.|      ..|:..|::..|.|.|:.|::
  Rat     9 LLIVGAVIVIEGLQAAQRACGQRGPGPPEPQEGNTLPG------EWPWQASVRRQGVHICSGSLV 67

  Fly    67 NANWLVTAAHCLTN--SNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMI 129
            ...|::|||||...  :.::...::|.||:..:|.:...:...:....:...|...:...|:.::
  Rat    68 ADTWVLTAAHCFEKMATAELSSWSVVLGSLKQEGLSPGAEEVGVAALQLPKAYNHYSQGSDLALL 132

  Fly   130 YTPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASY-----PSTLQVATNVPIISL- 188
            ......|.:....|   ..:...|.| |:.:..|....|:...|     ....|..:.:.:::| 
  Rat   133 QLTHPIVHTTLCLP---QPTHHFPFG-ASCWATGWDQNTSDGKYCPRHKSRESQTGSVLTVLALC 193

  Fly   189 SSCESALGTK-----------------------------------GSDVHSTNLCTGPLTGGVSI 218
            |.|.|.|.:.                                   .:...|..||.|...|....
  Rat   194 SHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNRLHQRLLANPARSGMLCGGAQPGVQGP 258

  Fly   219 CTSDSGGPLV----QGN-VLIGIVSWGKLPCGQANSPSVYVQVSSFISWISAN 266
            |..|||||::    .|: |.:||:|:.. .|.|.::|.:...:::..||:.|:
  Rat   259 CQGDSGGPVMCREPDGHWVQVGIISFTS-NCAQEDTPVLLTDMAAHSSWLQAH 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 53/275 (19%)
Tryp_SPc 36..266 CDD:238113 54/277 (19%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 54/275 (20%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.