DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Prss36

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:246 Identity:72/246 - (29%)
Similarity:116/246 - (47%) Gaps:16/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGS---TLVAGS 93
            |..|:||||.|...:.|:.||:.:||.|.|..|::..:|:::||||...:..:..:   :::.|.
  Rat    55 PSSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSVLLGV 119

  Fly    94 IAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLP-SSGVVPTGTA 157
            .:.||.......||:...::.|.|:...:..|:.::...:......:|.||.|| :|.:...|||
  Rat   120 HSQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCLPRASHLFAHGTA 184

  Fly   158 N-LYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGS-----DVHSTNLCTGPLTGGV 216
            . ..|||....::....|..|| ...:.::..::|:......|.     .:....||.|...|..
  Rat   185 CWATGWGDVQESDPLPVPWVLQ-EVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCAGYPEGRR 248

  Fly   217 SICTSDSGGPLV--QGN--VLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263
            ..|..|||||||  .|.  .|.||.|:| ..||:.|.|.|:..|:.:.|||
  Rat   249 DTCQGDSGGPLVCEDGGRWFLAGITSFG-FGCGRRNRPGVFTAVAHYESWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 69/241 (29%)
Tryp_SPc 36..266 CDD:238113 70/242 (29%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 70/242 (29%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.