DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG34130

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:233 Identity:55/233 - (23%)
Similarity:95/233 - (40%) Gaps:24/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVDGT 99
            |..||     ::.|:.:.:..|.|..|.||.|:|.:.:|:|:|:.:....:.|.    |:.:..:
  Fly    48 RTSGG-----HAVPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESL----SVELVSS 103

  Fly   100 ASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSG----VVPTGTANLY 160
            .|....:..::...|.|.....|..|   .:.|..|: ..||..:|....|    .|...|..|.
  Fly   104 DSRQDNQLDSHDPPNALIRNIIVSKD---WHWPGTFM-DVAVIELTNRLRGNRNNYVTLCTNPLS 164

  Fly   161 GWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGG 225
            .:.|.|..:..:.|:.......:.:::...|:||.|  ...:..|..|......... |...:|.
  Fly   165 SYKSLSVVSYGAGPAENVRTEEIEVLNRMICDSAYG--NFLLRETVACAKEFKRSAD-CMFSAGC 226

  Fly   226 PLVQGNVLIGIVSWGKLPCGQANSPSVYV---QVSSFI 260
            |:..|:.|.|||:|.. .|.::|.|.::.   ||..||
  Fly   227 PVTAGDQLCGIVAWSP-ACKRSNLPGIFTDIHQVKRFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 55/233 (24%)
Tryp_SPc 36..266 CDD:238113 54/232 (23%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 50/221 (23%)
Tryp_SPc 53..256 CDD:304450 48/214 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.